PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002105G0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 415aa    MW: 44039.8 Da    PI: 8.4239
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002105G0190genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.12.8e-19336370135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  PH01002105G0190 336 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 370
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.3E-18330384IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.991330366IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.47E-14333393No hitNo description
Gene3DG3DSA:3.30.50.101.9E-15334368IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.55E-14335377No hitNo description
PfamPF003202.9E-17336370IPR000679Zinc finger, GATA-type
PROSITE patternPS003440336361IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MTHQTLISST PAFSSASHFP HAASSSSSPS LSPRSSYSCA AAATSVMSSF AHHHGSLVER  60
EGRMAALRSS HRTYEAAEEM AAAAAAGPAA WGAAERGVGL LGEGFSVEDL LDLEELCEVD  120
KEVGELCEAA PAAVEEKSSD SHGSSVVSYE LMPLPPPVID LPAHDAEELE WVSRIMDDSL  180
AELPPPPQLP AAPLAAWPPK HRRPQEAALS AADPMRSPTI CALSTEALVP VKAKRSKRSR  240
GSVWSLSGVP LSDSTSSSST TSSCSSSGSF SPLLLLDSPT FVVSDLLDEP TRPKKYKHGK  300
NGKHKPKKRG RKPKHHLLPQ LSGAAASPPF PGDRRCSHCG VQKTPQWRAG PEGAKTLCNA  360
CGVRYKSGRL LPEYRPACSP TYVSALHSNS HRKVLEMRRK KESVIIAAAP AVASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0935410.0FP093541.1 Phyllostachys edulis cDNA clone: bphylf026a09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688677.11e-138PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 5-like, partial
TrEMBLA0A0A9LJV31e-144A0A0A9LJV3_ARUDO; Uncharacterized protein
STRINGLOC_Os02g43150.11e-136(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-39GATA transcription factor 5